CoraLite® Plus 488-conjugated PUM1 Recombinant monoclonal antibody

PUM1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-86129
Clone No.250792G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

HsPUM, KIAA0099, PUMH, PUMH1, Pumilio 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86129 targets PUM1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24651

Product name: Recombinant human PUM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-128 aa of BC013398

Sequence: MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDEL

Predict reactive species
Full Name pumilio homolog 1 (Drosophila)
Calculated Molecular Weight 1186 aa, 126 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC013398
Gene Symbol PUM1
Gene ID (NCBI) 9698
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14671
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PUM1, also named as Pumilio homolog 1, is a 1186 amino acid protein, which is expressed in brain, heart, kidney, muscle, intestine and stomach. PUM1 as sequence-specific RNA-binding protein that acts as a post-transcriptional repressor by binding the 3'-UTR of mRNA targets. PUM1 binds to an RNA consensus sequence, the Pumilio Response Element (PRE), 5'-UGUANAUA-3', that is related to the Nanos Response Element (NRE). The calculated molecular weight of PUM1 is 126 kDa, but the modified PUM1 is about 130-140 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PUM1 antibody CL488-86129Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...