CoraLite® Plus 488-conjugated PUM1 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-86129

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 PUM1 antibody (CL488-86129, Clone: 250792G4 ) at dilution of 1:200, CL594-Phalloidin (red).

PUM1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86129

Clone No.250792G4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

HsPUM, KIAA0099, PUMH, PUMH1, Pumilio 1

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86129 targets PUM1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24651

  Product name: Recombinant human PUM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-128 aa of BC013398

  Sequence: MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDEL

• Full Name: pumilio homolog 1 (Drosophila)
• Calculated Molecular Weight: 1186 aa, 126 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC013398
• Gene Symbol: PUM1
• Gene ID (NCBI): 9698
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14671
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PUM1, also named as Pumilio homolog 1, is a 1186 amino acid protein, which is expressed in brain, heart, kidney, muscle, intestine and stomach. PUM1 as sequence-specific RNA-binding protein that acts as a post-transcriptional repressor by binding the 3'-UTR of mRNA targets. PUM1 binds to an RNA consensus sequence, the Pumilio Response Element (PRE), 5'-UGUANAUA-3', that is related to the Nanos Response Element (NRE). The calculated molecular weight of PUM1 is 126 kDa, but the modified PUM1 is about 130-140 kDa.