PURB Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PURB Monoclonal antibody, PBS Only (61022-1-PBS)

• 

  WB analysis using 61022-1-Ig (same clone as 61022-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 61022-1-Ig (PURB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 61022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 61022-1-Ig (same clone as 61022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 61022-1-Ig (PURB antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 61022-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 61022-1-Ig (same clone as 61022-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 61022-1-Ig (PURB antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 61022-1-PBS in a different storage buffer formulation.

PURB Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 61022-1-PBS

Clone No.2F5G2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

PURBETA, Purine-rich element-binding protein B, Transcriptional regulator protein Pur-beta

---

Product Information

61022-1-PBS targets PURB in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

• Tested Reactivity: human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12816

  Product name: Recombinant human PURB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-312 aa of BC101735

  Sequence: MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED

• Full Name: purine-rich element binding protein B
• Calculated Molecular Weight: 312 aa, 33 kDa
• Observed Molecular Weight: 33-40 kDa
• GenBank Accession Number: BC101735
• Gene Symbol: PURB
• Gene ID (NCBI): 5814
• RRID: AB_3743258
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96QR8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PURB (Purine-rich element-binding protein B) is a ubiquitously expressed DNA/RNA-binding protein. It localizes to both the nucleus and cytoplasm, reflecting its dual role in transcriptional regulation and RNA metabolism. Its primary function is to bind purine-rich sequences to control gene expression, cell cycle progression, and differentiation. The observed molecular weight of PURB by SDS-PAGE is 33-40 kDa, which is close to its predicted molecular weight of ~33 kDa.