PWP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PWP2 Polyclonal antibody, PBS Only (11390-1-PBS)

• 

  WB analysis of HeLa using 11390-1-AP (same clone as 11390-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11390-1-AP (PWP2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11390-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 11390-1-AP (same clone as 11390-1-PBS)

  IP result of anti-PWP2 (IP:11390-1-AP, 4ug; Detection:11390-1-AP 1:600) with HeLa cells lysate 2400ug. This data was developed using the same antibody clone with 11390-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11390-1-AP (same clone as 11390-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using PWP2 antibody 11390-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 11390-1-PBS in a different storage buffer formulation.

PWP2 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 11390-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

11390-1-PBS targets PWP2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1936

  Product name: Recombinant human PWP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 520-919 aa of BC014988

  Sequence: SWDKTVRLWDMFDSWRTKETLALTSDALAVTIRPDGAELAVATLNSQITFWDPENAVQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFGNLALIDQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYSLDTRVLFDPFELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVLEFLASSFEVSRHLEFYLLWTHKLLMLHGQKLKSRAGTLLPVIQFLQKSIQRHLDDLSKLCSWNHYNMQYALAVSKQRGTKRSLDPLGSEEEAEASEDDSLHLLGGGGRDSEEEMLA

• Full Name: PWP2 periodic tryptophan protein homolog (yeast)
• Calculated Molecular Weight: 919 aa, 102 kDa
• Observed Molecular Weight: 102 kDa
• GenBank Accession Number: BC014988
• Gene Symbol: PWP2
• Gene ID (NCBI): 5822
• RRID: AB_2284709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15269
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The function of PWP2 remains largely unknown. Catalog#11390-1-AP is a rabbit polyclonal antibody raised against the full-length of human PWP2. The MW of this protein is 102 kDa, and this antibody specially recognises the 102 kDa protein.