PXR Monoclonal antibody, PBS Only

PXR Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 67912-1-PBS
Clone No.1G3A7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

NR1I2, 1G3A7, BXR, ONR1, Orphan nuclear receptor PAR1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67912-1-PBS targets PXR in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7991

Product name: Recombinant human PXR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 56-433 aa of BC017304

Sequence: MTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Predict reactive species
Full Name nuclear receptor subfamily 1, group I, member 2
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC017304
Gene Symbol PXR
Gene ID (NCBI) 8856
RRIDAB_2918667
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75469
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Pregnane X receptor (PXR; NR1I2), a member of the nuclear receptor superfamily, plays a key role in the induction of genes involved in drug transport and metabolism. It modulates drug transport and metabolism through the regulation of target genes responsible for the transport and conversion of chemicals into metabolites that are more easily eliminated from the body [PMID: 22609277]. It is also emerging as an endobiotic receptor that regulates the inflammatory response. In addition, PXR acts as a transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds [PMID: 19297428].

Loading...
||
New chat Able
正在加载,请稍候...