CoraLite® Plus 488-conjugated PXR Monoclonal antibody

PXR Monoclonal Antibody for FC (Intra)
Cat No. CL488-67912
Clone No.1G3A7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

NR1I2, 1G3A7, BXR, ONR1, Orphan nuclear receptor PAR1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67912 targets PXR in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7991

Product name: Recombinant human PXR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 56-433 aa of BC017304

Sequence: MTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS

Predict reactive species
Full Name nuclear receptor subfamily 1, group I, member 2
Calculated Molecular Weight 50 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC017304
Gene Symbol PXR
Gene ID (NCBI) 8856
RRIDAB_2934589
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75469
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Pregnane X receptor (PXR; NR1I2), a member of the nuclear receptor superfamily, plays a key role in the induction of genes involved in drug transport and metabolism. It modulates drug transport and metabolism through the regulation of target genes responsible for the transport and conversion of chemicals into metabolites that are more easily eliminated from the body [PMID: 22609277]. It is also emerging as an endobiotic receptor that regulates the inflammatory response. In addition, PXR acts as a transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds [PMID: 19297428].

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PXR antibody CL488-67912Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...