Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PYCR1 Polyclonal antibody

PYCR1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

PIG45, P5CR 1, P5CR, P5C reductase 1, P5C

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PYCR1 in ?

Tested Applications

Positive WB detected inHeLa cells, COLO 320 cells
Positive IP detected inHeLa cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22150-1-AP targets PYCR1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17745

Product name: Recombinant human PYCR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-148 aa of BC022244

Sequence: ALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVREGATVYATGTHAQVEDGRL

Predict reactive species
Full Name pyrroline-5-carboxylate reductase 1
Calculated Molecular Weight 319 aa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC022244
Gene Symbol PYCR1
Gene ID (NCBI) 5831
RRIDAB_11182280
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP32322
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PYCR1,also named as P5CR1, belongs to the pyrroline-5-carboxylate reductase family. It is a housekeeping enzyme that catalyzes the last step in proline biosynthesis. PYCR1 can utilize both NAD and NADP, but has higher affinity for NAD. It is involved in the cellular response to oxidative stress. Mutation in PYCR1 will cause ARCL type II(ARCL2B ). Some mutation will cause DeBarsy syndrome (DBS) which is characterized by progeroid features, ophthalmological abnormalities, intrauterine growth retardation, and cutis laxa. The MW of PYCR1 is about 33-35kd. This antibody may have cross reaction to PYCR2 due to the high homology.

Protocols

Product Specific Protocols
IF protocol for PYCR1 antibody 22150-1-APDownload protocol
IP protocol for PYCR1 antibody 22150-1-APDownload protocol
WB protocol for PYCR1 antibody 22150-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PYCR1 polyclonal antibody (Cat# 22150-1-AP) has 2 citations. One appears in Nature Metabolism, studying proline synthesis by PYCR1 in cancer-associated fibroblasts and extracellular matrix deposition. The other is in Journal of Psychiatric Research, examining region-specific dysregulation of proline metabolic enzymes linked to mitochondrial dysfunction in schizophrenia postmortem brains. The associated research fields are cancer metabolism and psychiatric neuroscience.

SpeciesApplicationTitle
humanWB

Nat Metab

Cancer-associated fibroblasts require proline synthesis by PYCR1 for the deposition of pro-tumorigenic extracellular matrix.

Authors - Emily J Kay
  • KD Validated

J Psychiatr Res

Region-specific dysregulation of proline metabolic enzymes underlying mitochondrial dysfunction in the postmortem brains of patients with schizophrenia.

Authors - Atsuko Nagaoka
Loading...
||
New chat

Able™

正在加载,请稍候...