Product Information
31736-1-PBS targets Pannexin 3 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34451 Product name: Recombinant human PANX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 289-392 aa of NM_052959 Sequence: YNLTRLCRWDKRLLSVYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLCVLKDTTTQKHNIDTVVDFMTLLAGLEPSKPKHLTNSACDEHP Predict reactive species |
| Full Name | pannexin 3 |
| Calculated Molecular Weight | 392 aa, 45 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | NM_052959 |
| Gene Symbol | PANX3 |
| Gene ID (NCBI) | 116337 |
| RRID | AB_3742466 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96QZ0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Pannexin 3 (PANX3) is a member of the pannexin family of single membrane channel-forming glycoproteins. PANX3 is expressed in osteoblasts, chondrocytes, and skin and plays a major role in calcium homeostasis suggesting an independent functional niche. PANX3 regulates both chondrocyte and osteoblast differentiation via the activation of intracellular Ca2+ signaling pathways through multiple channel activities: hemichannels, endoplasmic reticulum (ER) Ca2+ channels, and gap junctions. PANX3 has 392 amino acids with a molecular weight of ~ 43 kDa and is N-linked glycosylated at asparagine residue 71 in the first extracellular loop (PMID: 27837015, PMID: 34250568, PMID: 38580658).
