CoraLite® Plus 488-conjugated Perforin Polyclonal antibody

Perforin Polyclonal Antibody for
Cat No. CL488-14580

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

Perforin 1, P1, Lymphocyte pore-forming protein, HPLH2, FLH2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL488-14580 targets Perforin in applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6060

Product name: Recombinant human Perforin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 247-555 aa of BC063043

Sequence: EGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

Predict reactive species
Full Name perforin 1 (pore forming protein)
Calculated Molecular Weight 61 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC063043
Gene Symbol Perforin
Gene ID (NCBI) 5551
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14222
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Perforin 1 (PRF1) is one of the major cytolytic proteins of cytolytic granules. It is known to be a crucial effector molecule in cytolytic T lymphocyte and natural killer cell-mediated cytotoxicity. This protein has structural and functional similarities to complement component C9. Like C9, this protein creates transmembrane tubules and is capable of lysing nonspecifically a variety of target cells. Defects in PRF1 are the cause of familial hemophagocytic lymphohistiocytosis type 2 (FHL2), which is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. (PMID: 2417226; 7774276; 2783486; 10583959)

Loading...
||
New chat

Able

正在加载,请稍候...