Tested Applications
| Positive WB detected in | human heart tissue, rat heart tissue, T-47D cells, A431 cells, MDCK cells, HT-29 cells |
| Positive IHC detected in | human breast cancer tissue, human skin tissue, human stomach cancer tissue, mouse stomach tissue, rat stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells, MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66445-1-Ig targets Gamma Catenin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, canine samples.
| Tested Reactivity | human, mouse, rat, pig, canine |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1627 Product name: Recombinant human JUP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 396-745 aa of BC011865 Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species |
| Full Name | junction plakoglobin |
| Calculated Molecular Weight | 82 kDa |
| Observed Molecular Weight | 82 kDa |
| GenBank Accession Number | BC011865 |
| Gene Symbol | Gamma Catenin |
| Gene ID (NCBI) | 3728 |
| RRID | AB_2881814 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P14923 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Gamma Catenin antibody 66445-1-Ig | Download protocol |
| IHC protocol for Gamma Catenin antibody 66445-1-Ig | Download protocol |
| WB protocol for Gamma Catenin antibody 66445-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Gamma Catenin (Plakoglobin) Monoclonal antibody (1A5D10), catalog number 66445-1-Ig, has 3 total citations. These appear in Oxidative Medicine and Cellular Longevity, International Journal of Molecular Sciences, and Aging (Albany NY). The associated research fields include gastric cancer metastasis and growth (BRD4/Snail, γ-catenin/PTEN-PI3K-AKT pathways) and bronchial epithelial barrier function.
| Species | Application | Title |
|---|---|---|
Oxid Med Cell Longev DSC2 Suppresses the Metastasis of Gastric Cancer through Inhibiting the BRD4/Snail Signaling Pathway and the Transcriptional Activity of β-Catenin | ||
Int J Mol Sci The Non-Antibacterial Effects of Azithromycin and Other Macrolides on the Bronchial Epithelial Barrier and Cellular Differentiation | ||
Aging (Albany NY) DSC2 suppresses the growth of gastric cancer through the inhibition of nuclear translocation of γ-catenin and PTEN/PI3K/AKT signaling pathway |
Reviews
What customers say
Customer feedback is mixed. One reviewer rated the antibody 5 stars for use in Western Blot, Immunofluorescence, Immunoprecipitation, and Cell Culture on human samples, with no additional comments. Another reviewer gave 1 star, reporting multiple bands and high background in Western Blot (1:2000, overnight at 4°C, 3% BSA PBS 0.1% Tween, PVDF membrane) and non-specific, non-junctional signaling in Immunofluorescence (1:200, 4% PFA-fixed HUVEC cells). Overall, results appear to be protocol- and sample-dependent.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ashley (Verified Customer) (02-25-2026) |
|
Tom (Verified Customer) (11-02-2023) | Multiple bands and high background in western blot (1:2000, overnight incubation at 4C in 3% BSA PBS 0.1% Tween on PVDF membrane). Non-specific (and non-junctional) signalling in immunoflouresence (1:200, 4% PFA fixed cells).
 |
