CoraLite® Plus 488-conjugated Gamma Catenin Monoclonal antibody

Gamma Catenin Monoclonal Antibody for WB
Cat No. CL488-66445
Clone No.1A5D10

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig, Canine

Applications

WB

ARVD12, Catenin gamma, CTNNG, Desmoplakin 3, Desmoplakin III, DP3, DPIII, junction plakoglobin, JUP, PDGB, PKGB, γ-Catenin

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-29 cells, T-47D cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66445 targets Gamma Catenin in WB applications and shows reactivity with human, rat, pig, Canine samples.

Tested Reactivity human, rat, pig, Canine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1627

Product name: Recombinant human JUP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 396-745 aa of BC011865

Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA

Predict reactive species
Full Name junction plakoglobin
Calculated Molecular Weight 82 kDa
Observed Molecular Weight 82 kDa
GenBank Accession NumberBC011865
Gene Symbol Gamma Catenin
Gene ID (NCBI) 3728
RRIDAB_3084247
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP14923
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 Gamma Catenin antibody CL488-66445Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...