Plakophilin 1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse skin using 85217-4-RR (same clone as 85217-4-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 85217-4-RR (Plakophilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85217-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 85217-4-RR (same clone as 85217-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85217-4-RR (Plakophilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85217-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85217-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85217-4-RR against Human Plakophilin 1 were performed. The affinity constant is 11.4 nM.

Plakophilin 1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85217-4-PBS

Clone No.242834G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

PKP1, 242834G8, B6P, Plakophilin-1

---

Product Information

85217-4-PBS targets Plakophilin 1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18153

  Product name: Recombinant human PKP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 412-726 aa of BC114571

  Sequence: NLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF

• Full Name: plakophilin 1 (ectodermal dysplasia/skin fragility syndrome)
• Calculated Molecular Weight: 747 aa, 83 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC114571
• Gene Symbol: PKP1
• Gene ID (NCBI): 5317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13835
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Plakophilin 1, also known as PKP1, B6P, is a member of the arm-repeat protein family. PKP1 contains arm-repeat (armadillo) domains, localizes to nuclei and cell desmosomes, and participates in linking cadherins to intermediate filaments in the cytoskeleton (PMID: 10747098). PKP1 contributes to epidermal morphogenesis and facilitates the formation of intermediate filaments. Mutations in PKP1 have been associated with the ectodermal dysplasia/skin fragility syndrome (PubMed:9326952, 10852826).