Podocalyxin Monoclonal antibody, PBS Only

Podocalyxin Monoclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 68250-1-PBS
Clone No.4A3C7

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

IHC, IF-P, Indirect ELISA

GCTM 2 antigen, Gp200, PC, PCLP, PCLP 1, PCLP1, Podocalyxin, podocalyxin like, Podocalyxin like protein 1, PODXL, RCC marker, TRA 1 81,TRA 1 60

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68250-1-PBS targets Podocalyxin in IHC, IF-P, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12859

Product name: Recombinant human TRA-1-60 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 23-428 aa of BC093730

Sequence: SPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLPSSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSM

Predict reactive species
Full Name podocalyxin-like
Calculated Molecular Weight 526 aa, 55 kDa
Observed Molecular Weight60-70 kDa
GenBank Accession NumberBC093730
Gene Symbol Podocalyxin
Gene ID (NCBI) 5420
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00592
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Podocalyxin, also known as podocalyxin-like protein 1 (PODXL or PCLP1), is a transmembrane glycoprotein belonging to the CD34 family of sialomucins. Podocalyxin was originally identified as the major sialoprotein on podocytes of the kidney glomerulus, but was later found to be expressed on vascular endothelial cells and early hematopoietic progenitors. It Involved in the regulation of both adhesion and cell morphology. In addition, podocalyxin is highly expressed in embryonic stem cells and aberrant expression of podocalyxin has been implicated in a wide range of cancers. Podocalyxin is a protein with a peptide bone of ∼55.5 kDa that undergoes a post‐translational glycosylation, the different molecular mass of podocalyxin indicates the extent and variability of glycosylation patterns (PMID: 17092254).

Loading...
||
New chat Able
正在加载,请稍候...