Mouse Pon3 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86577-1-RR (same clone as 86577-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86577-1-RR (Pon3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86577-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02543-1

  Serum of six mice was measured. The PON3 concentration of detected samples was determined to be 19.6 ng/mL with a range of 16.7-21.2 ng/mL.

• 

  Sandwich ELISA sample test of MP02543-1

  The mean PON3 concentration was determined to be 41.6 ng/mL in RAW 264.7 cell extract based on a 1.3 mg/mL extract load and 1,033.8 ng/mL in mouse liver tissue extract based on a 8.4 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02543-1

  Sandwich ELISA standard curve of MP02543-1, Mouse PON3 Recombinant Matched Antibody Pair - PBS only. 86577-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg2743. 86577-1-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  Cytometric bead array sample test of MP02543-1

  The mean PON3 concentration was determined to be 986.3 ng/mL in Mouse liver tissue extract based on a 8.4 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02543-1

  Cytometric bead array standard curve of MP02543-1, MOUSE PON3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86577-2-PBS. Detection antibody: 86577-1-PBS. Standard: Eg2743. Range: 0.469-60 ng/mL.

Pon3 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86577-1-PBS

Clone No.251535H2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

EC:3.1.8.1, Paraoxanase-3, Serum paraoxonase/lactonase 3

---

Product Information

86577-1-PBS targets Pon3 as part of a matched antibody pair:

MP02543-1: 86577-2-PBS capture and 86577-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2743

  Product name: Recombinant Mouse Pon3 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-354 aa of NM_173006.1

  Sequence: RLLNFRERVSTTREIKATEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPAFAPDKPGRIFLMDLNEQNPEAQALEISGGLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRMLIGTIFHKALYCDL

• Full Name: paraoxonase 3
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_173006.1
• Gene Symbol: Pon3
• Gene ID (NCBI): 269823
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62087
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PON3 (paraoxonase 3) is a member of the paraoxonase gene family and shares high homology with PON1 and PON2. The PON3 protein is primarily synthesized by the liver and can bind to high-density lipoprotein (HDL), where it exerts antioxidant functions. PON3 can prevent the oxidation of low-density lipoprotein (LDL) and disrupt bacterial quorum-sensing molecules. Additionally, PON3 is expressed in mouse models of Alzheimer's disease (AD), with positive staining for PON3 detected in astrocytes surrounding Aβ plaques. These findings suggest that PON3 plays an important role in antioxidant stress and lipid peroxidation and may have potential protective effects on pathological processes such as neurodegenerative diseases and atherosclerosis.