Pon3 Recombinant monoclonal antibody

• 

  WB analysis using 86577-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86577-1-RR (Pon3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

Pon3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86577-1-RR

Clone No.251535H2

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Synonyms

EC:3.1.8.1, Paraoxanase-3, Serum paraoxonase/lactonase 3

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, rat kidney tissue, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86577-1-RR targets Pon3 in WB, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2743

  Product name: Recombinant Mouse Pon3 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 20-354 aa of NM_173006.1

  Sequence: RLLNFRERVSTTREIKATEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPAFAPDKPGRIFLMDLNEQNPEAQALEISGGLDQESLNPHGISTFIDKDNTAYLYVVNHPNMDSTVEIFKFEEQQRSLIHLKTLKHELLKSVNDIVVLGPEQFYATRDHYFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKNIHIMKKHDNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDSLSDKPRVSTLYANNGSVLQGSTVASVYHKRMLIGTIFHKALYCDL

• Full Name: paraoxonase 3
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_173006.1
• Gene Symbol: Pon3
• Gene ID (NCBI): 269823
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62087
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PON3 (paraoxonase 3) is a member of the paraoxonase gene family and shares high homology with PON1 and PON2. The PON3 protein is primarily synthesized by the liver and can bind to high-density lipoprotein (HDL), where it exerts antioxidant functions. PON3 can prevent the oxidation of low-density lipoprotein (LDL) and disrupt bacterial quorum-sensing molecules. Additionally, PON3 is expressed in mouse models of Alzheimer's disease (AD), with positive staining for PON3 detected in astrocytes surrounding Aβ plaques. These findings suggest that PON3 plays an important role in antioxidant stress and lipid peroxidation and may have potential protective effects on pathological processes such as neurodegenerative diseases and atherosclerosis.