Pregnancy Zone Protein Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Pregnancy Zone Protein Polyclonal antibody, PBS Only (21742-1-PBS)

• 

  WB analysis using 21742-1-AP (same clone as 21742-1-PBS)

  Human plasma were subjected to SDS PAGE followed by western blot with 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21742-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 21742-1-AP (same clone as 21742-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 21742-1-AP (same clone as 21742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21742-1-AP (Pregnancy Zone Protein antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 21742-1-AP (same clone as 21742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21742-1-AP (Pregnancy Zone Protein antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 21742-1-AP (same clone as 21742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 21742-1-AP (same clone as 21742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 21742-1-AP (pregnancy zone protein antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21742-1-PBS in a different storage buffer formulation.

Pregnancy Zone Protein Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21742-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

PZP, pregnancy-zone protein

---

Product Information

21742-1-PBS targets Pregnancy Zone Protein in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16471

  Product name: Recombinant human PZP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-690 aa of BC111756

  Sequence: ITAHYTLNRQAMGELSELSFHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFAILPDGEVVGDSEKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSVLLMKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVL

• Full Name: pregnancy-zone protein
• Calculated Molecular Weight: 1482 aa, 164 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC111756
• Gene Symbol: Pregnancy Zone Protein
• Gene ID (NCBI): 5858
• RRID: AB_10732823
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20742
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pregnancy Zone Protein (PZP) is an immunosuppressive protein that is expressed by the placenta. The PZP is a thiol ester-containing alpha macroglobulin protein that controls the proteolytic pathways during pregnancy and contributes to maintaining the immunologically privileged status of the fetus. Recently PZP over-expression has been described as a novel biomarker for predicting the prognosis of hepatocellular carcinoma and its high expression has been reported in solid tumors.