Pregnancy Zone Protein Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 84605-4-RR (same clone as 84605-4-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 84605-4-RR (Pregnancy Zone Protein antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84605-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84605-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84605-4-RR against Human Pregnancy Zone Protein were performed. The affinity constant is below 1 pM.

Pregnancy Zone Protein Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84605-4-PBS

Clone No.242114A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

PZP, pregnancy-zone protein, 242114A6

---

Product Information

84605-4-PBS targets Pregnancy Zone Protein in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16471

  Product name: Recombinant human PZP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-690 aa of BC111756

  Sequence: ITAHYTLNRQAMGELSELSFHYLIMAKGVIVRSGTHTLPVESGDMKGSFALSFPVESDVAPIARMFIFAILPDGEVVGDSEKFEIENCLANKVDLSFSPAQSPPASHAHLQVAAAPQSLCALRAVDQSVLLMKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVL

• Full Name: pregnancy-zone protein
• Calculated Molecular Weight: 1482 aa, 164 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC111756
• Gene Symbol: Pregnancy Zone Protein
• Gene ID (NCBI): 5858
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P20742
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Pregnancy Zone Protein (PZP) is an immunosuppressive protein that is expressed by the placenta. The PZP is a thiol ester-containing alpha macroglobulin protein that controls the proteolytic pathways during pregnancy and contributes to maintaining the immunologically privileged status of the fetus. Recently PZP over-expression has been described as a novel biomarker for predicting the prognosis of hepatocellular carcinoma and its high expression has been reported in solid tumors.