• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Prohibitin 2 Monoclonal antibody

Prohibitin 2 Monoclonal Antibody for IF/ICC
Cat No. CL488-66424
Clone No.1D9C7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

BAP, Bap37, D prohibitin, p22, PHB2, PNAS 141, prohibitin 2, REA

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66424 targets Prohibitin 2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2977

Product name: Recombinant human PHB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-299 aa of BC014766

Sequence: MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Predict reactive species
Full Name prohibitin 2
Calculated Molecular Weight 299 aa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC014766
Gene Symbol Prohibitin 2
Gene ID (NCBI) 11331
RRIDAB_2883335
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99623
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PHB2, also named as BAP, REA, D-prohibitin, BAP37 and Prohibitin-2, belongs to the prohibitin family. It acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. PHB2 functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. PHB2 is probably involved in regulating mitochondrial respiration activity and in aging.(PMID: 10359819)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Prohibitin 2 antibody CL488-66424Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sara (Verified Customer) (10-06-2024)

It works in HEK cells (human), partial colocalisation with mitochondria is seen when using Mitotracker. Very easy staining, as the antibody is already conjugated to Coralite 488. I fixed with 4% PFA, perm and stain overnight.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HEK
CL Plus 488 Prohibitin 2 Antibody Immunofluorescence validation (1:100 dilution) in HEK (Cat no:CL488-66424)
Loading...
||
New chat Able
正在加载,请稍候...