Mouse Prolactin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85042-1-RR (same clone as 85042-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85042-1-RR (Prolactin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85042-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pituitary gland using 85042-1-RR (same clone as 85042-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pituitary gland tissue slide using 85042-1-RR (Prolactin antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85042-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pituitary gland using 85042-1-RR (same clone as 85042-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pituitary gland tissue slide and mouse spleen tissue slide (negative control) using 85042-1-RR (Prolactin antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85042-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pituitary gland using 85042-1-RR (same clone as 85042-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pituitary gland tissue using Prolactin antibody (85042-1-RR, Clone: 241771A5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85042-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pituitary gland using 85042-1-RR (same clone as 85042-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pituitary gland tissue using Prolactin antibody (85042-1-RR, Clone: 241771A5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85042-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85042-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85042-1-RR against Mouse Prolactin were performed. The affinity constant is 4.50 nM.

Prolactin Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 85042-1-PBS

Clone No.241771A5

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

241771A5

---

Product Information

85042-1-PBS targets Prolactin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0937

  Product name: recombinant mouse Prolactin protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 32-228 aa of NP_035294.2

  Sequence: LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

• Full Name: prolactin
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NP_035294.2
• Gene Symbol: Prl
• Gene ID (NCBI): 19109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Prolactin is also named as PRL and belongs to the somatotropin/prolactin family. The proteins encoded by PRL are secreted into the cell surroundings. And they are abundantly expressed in pituitary gland, adenohypophysis, decidua and testis. Indeed, chemically, prolactin appears in a multiplicity of posttranslational forms ranging from size variants to chemical modifications such as phosphorylation or glycosylation. It is not only synthesized in the pituitary gland, as originally described, but also within the central nervous system, the immune system, the uterus and its associated tissues of conception, and even the mammary gland itself (PMID: 11015620). Prolactin acts primarily on the mammary gland by promoting lactation (PMID: 30546056).