Prolactin Recombinant monoclonal antibody

Prolactin Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 85042-1-RR
Clone No.241771A5

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF-P, ELISA

241771A5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, rat lung tissue, rat spleen tissue
Positive IHC detected inmouse pituitary gland tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pituitary gland tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)-PIF-P : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85042-1-RR targets Prolactin in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0937

Product name: recombinant mouse Prolactin protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 32-228 aa of NP_035294.2

Sequence: LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Predict reactive species
Full Name prolactin
Calculated Molecular Weight26 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberNP_035294.2
Gene Symbol Prl
Gene ID (NCBI) 19109
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prolactin is also named as PRL and belongs to the somatotropin/prolactin family. The proteins encoded by PRL are secreted into the cell surroundings. And they are abundantly expressed in pituitary gland, adenohypophysis, decidua and testis. Indeed, chemically, prolactin appears in a multiplicity of posttranslational forms ranging from size variants to chemical modifications such as phosphorylation or glycosylation. It is not only synthesized in the pituitary gland, as originally described, but also within the central nervous system, the immune system, the uterus and its associated tissues of conception, and even the mammary gland itself (PMID: 11015620). Prolactin acts primarily on the mammary gland by promoting lactation (PMID: 30546056).

Protocols

Product Specific Protocols
IF protocol for Prolactin antibody 85042-1-RRDownload protocol
IHC protocol for Prolactin antibody 85042-1-RRDownload protocol
WB protocol for Prolactin antibody 85042-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...