QPCT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• QPCT Polyclonal antibody, PBS Only (18571-1-PBS)

• 

  WB analysis using 18571-1-AP (same clone as 18571-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18571-1-AP (QPCT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18571-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18571-1-AP (same clone as 18571-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18571-1-AP (QPCT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18571-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 18571-1-AP (same clone as 18571-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using QPCT antibody (18571-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 18571-1-PBS in a different storage buffer formulation.

QPCT Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 18571-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC, EC:2.3.2.5, Glutaminyl cyclase, glutaminyl peptide cyclotransferase, Glutaminyl-peptide cyclotransferase

---

Product Information

18571-1-PBS targets QPCT in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13416

  Product name: Recombinant human QPCT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-361 aa of BC047756

  Sequence: MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

• Full Name: glutaminyl-peptide cyclotransferase
• Calculated Molecular Weight: 361 aa, 41 kDa
• Observed Molecular Weight: 41 kDa, 35 kDa
• GenBank Accession Number: BC047756
• Gene Symbol: QPCT
• Gene ID (NCBI): 25797
• RRID: AB_3669301
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16769
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glutaminyl-peptide cyclotransferase (QPCT) gene encodes glutaminyl cyclase (QC), an enzyme that plays a role in post-translational modification of proteins by converting N-terminal glutamate to pyroglutamine. QPCT plays a specific role in promoting tumor cell proliferation, migration and angiogenesis as well as in inhibiting tumor cell apoptosis in cancers such as thyroid cancer and renal cell carcinoma (PMID: 38417050). Human QPCT has two isoforms produced by alternative splicing, 41 kDa and 35 kDa, respectively.