RAB12 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAB12 Polyclonal antibody, PBS Only (29927-1-PBS)

• 

  WB analysis using 29927-1-AP (same clone as 29927-1-PBS)

  Human brain tissue was subjected to SDS PAGE followed by western blot with 29927-1-AP (RAB12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29927-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29927-1-AP (same clone as 29927-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29927-1-AP (RAB12 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29927-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 29927-1-AP (same clone as 29927-1-PBS)

  IP result of anti-RAB12 (IP:29927-1-AP, 4ug; Detection:29927-1-AP 1:1500) with mouse brain tissue lysate 2100 ug. This data was developed using the same antibody clone with 29927-1-PBS in a different storage buffer formulation.

RAB12 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 29927-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

29927-1-PBS targets RAB12 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31627

  Product name: Recombinant human RAB12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-244 aa of NM_001025300

  Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

• Full Name: RAB12, member RAS oncogene family
• Calculated Molecular Weight: 27KD
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001025300
• Gene Symbol: RAB12
• Gene ID (NCBI): 201475
• RRID: AB_3669700
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6IQ22
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rab12, a previously uncharacterized Rab isoform, is mainly localized at TfR-positive recycling endosomes and is specifically involved in TfR degradation. Rab12 is a regulator of LRRK2 and its activation by damaged lysosomes.