RAB12 Recombinant monoclonal antibody

• 

  WB analysis using 86560-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86560-1-RR (RAB12 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86560-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86560-1-RR against Human RAB12 were performed. The affinity constant is 0.200 nM.

RAB12 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86560-1-RR

Clone No.251398D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Ras related protein Rab 12, Ras-related protein Rab-12

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86560-1-RR targets RAB12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31627

  Product name: Recombinant human RAB12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-244 aa of NM_001025300

  Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

• Full Name: RAB12, member RAS oncogene family
• Calculated Molecular Weight: 27KD
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001025300
• Gene Symbol: RAB12
• Gene ID (NCBI): 201475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6IQ22
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB12 belongs to the small GTPase superfamily and Rab family. RAB12 locates in Golgi apparatus membrane. Rab12, a previously uncharacterized Rab isoform, is mainly localized at TfR-positive recycling endosomes and is specifically involved in TfR degradation. Rab12 is a regulator of LRRK2 and its activation by damaged lysosomes.