RAB12 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86560-1-RR (same clone as 86560-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86560-1-RR (RAB12 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86560-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86560-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86560-1-RR against Human RAB12 were performed. The affinity constant is 0.200 nM.

RAB12 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86560-1-PBS

Clone No.251398D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Ras related protein Rab 12, Ras-related protein Rab-12

---

Product Information

86560-1-PBS targets RAB12 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31627

  Product name: Recombinant human RAB12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 105-244 aa of NM_001025300

  Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

• Full Name: RAB12, member RAS oncogene family
• Calculated Molecular Weight: 27KD
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001025300
• Gene Symbol: RAB12
• Gene ID (NCBI): 201475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6IQ22
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB12 belongs to the small GTPase superfamily and Rab family. RAB12 locates in Golgi apparatus membrane. Rab12, a previously uncharacterized Rab isoform, is mainly localized at TfR-positive recycling endosomes and is specifically involved in TfR degradation. Rab12 is a regulator of LRRK2 and its activation by damaged lysosomes.