RAB14 Monoclonal antibody, PBS Only

• 

  WB analysis using 67953-1-Ig (same clone as 67953-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67953-1-Ig (RAB14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67953-1-Ig (same clone as 67953-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67953-1-Ig (RAB14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67953-1-Ig (same clone as 67953-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67953-1-Ig (RAB14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 67953-1-Ig (same clone as 67953-1-PBS)

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 67953-1-Ig (RAB14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67953-1-Ig (same clone as 67953-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67953-1-Ig (RAB14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67953-1-Ig (same clone as 67953-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67953-1-Ig (RAB14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67953-1-Ig (same clone as 67953-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67953-1-Ig (RAB14 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 67953-1-Ig (same clone as 67953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 67953-1-Ig (RAB14 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67953-1-Ig (same clone as 67953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67953-1-Ig (RAB14 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 67953-1-Ig (same clone as 67953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 67953-1-Ig (RAB14 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 67953-1-Ig (same clone as 67953-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 67953-1-Ig (RAB14 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67953-1-Ig (same clone as 67953-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RAB14 antibody (67953-1-Ig, Clone: 3G7B3 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 67953-1-PBS in a different storage buffer formulation.

RAB14 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67953-1-PBS

Clone No.3G7B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

3G7B3, EC:3.6.5.2, FBP, RAB 14, Ras related protein Rab 14

---

Product Information

67953-1-PBS targets RAB14 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8167

  Product name: Recombinant human RAB14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-215 aa of BC006081

  Sequence: MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC

• Full Name: RAB14, member RAS oncogene family
• Calculated Molecular Weight: 215 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC006081
• Gene Symbol: RAB14
• Gene ID (NCBI): 51552
• RRID: AB_2918705
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P61106
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB14, the final member of the Rab11 subfamily, participates in the regulation of cell secretion, ensuring the timely release of necessary substances outside the cell. RAB14 is ubiquitously expressed and localizes to the Golgi/TGN and at early endosomes (PMID: 16962593, 22595670). RAB14 contains 215 amino acids, with a molecular weight of approximately 24.6 kDa