Rab18 Monoclonal antibody

• 

  IF Staining of mouse brain using 60057-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 60057-1-Ig (Rab18 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated Goat Anti-Mouse IgG(H+L).

Rab18 Monoclonal Antibody for ELISA

Cat No. 60057-1-Ig

Clone No.4D5B8

Publications(4)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

RAB18, RAB18LI1, Ras related protein Rab 18

---

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

60057-1-Ig targets Rab18 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse, monkey
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1841

  Product name: Recombinant human RAB18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC015014

  Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL

• Full Name: RAB18, member RAS oncogene family
• Calculated Molecular Weight: 206 aa, 23 kDa
• GenBank Accession Number: BC015014
• Gene Symbol: RAB18
• Gene ID (NCBI): 22931
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NP72
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB18 is a member of a family of Ras-related small GTPases. RAB18 plays a role in apical endocytosis/recycling, and may be implicated in transport between the plasma membrane and early endosomes. It also plays a key role in eye and brain development and neurodegeneration. Defects in RAB18 are associated with Warburg micro syndrome type 3.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
monkey	WB	J Cell Biol; Rab18 and a Rab18 GEF complex are required for normal ER structure.; Authors - Andreas Gerondopoulos
mouse	IF	Redox Biol; Homocysteine promotes hepatic steatosis by activating the adipocyte lipolysis in a HIF1α-ERO1α-dependent oxidative stress manner.; Authors - Yu Yan
mouse	IF	J Cell Biol; Rab18 promotes lipid droplet (LD) growth by tethering the ER to LDs through SNARE and NRZ interactions.; Authors - Dijin Xu
mouse	WB	Mol Neurobiol; Rab18 Collaborates with Rab7 to Modulate Lysosomal and Autophagy Activities in the Nervous System: an Overlapping Mechanism for Warburg Micro Syndrome and Charcot-Marie-Tooth Neuropathy Type 2B.; Authors - Fang-Shin Nian