RAB18 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 67659-1-Ig (same clone as 67659-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67659-1-Ig (RAB18 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67659-1-Ig (same clone as 67659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67659-1-Ig (RAB18 antibody) at dilution of 1:350 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67659-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67659-1-Ig (same clone as 67659-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67659-1-Ig (RAB18 antibody) at dilution of 1:350 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67659-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51469-1

  Cytometric bead array sample test of MP51469-1, RAB18 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67659-1-PBS. Detection antibody: 67659-2-PBS.

• 

  Cytometric bead array standard curve of MP51469-1

  Cytometric bead array standard curve of MP51469-1, RAB18 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67659-1-PBS. Detection antibody: 67659-2-PBS. Standard:Ag16669. Range: 3.125-400 ng/mL.

RAB18 Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 67659-1-PBS

Clone No.2E4B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

2E4B3, RAB18LI1, Ras related protein Rab 18, Ras-related protein Rab-18

---

Product Information

67659-1-PBS targets RAB18 as part of a matched antibody pair:

MP51469-1: 67659-1-PBS capture and 67659-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16669

  Product name: Recombinant human RAB18 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-206 aa of BC015014

  Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL

• Full Name: RAB18, member RAS oncogene family
• Calculated Molecular Weight: 206 aa, 23 kDa
• GenBank Accession Number: BC015014
• Gene Symbol: RAB18
• Gene ID (NCBI): 22931
• RRID: AB_2882856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NP72
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.