RAB18 Monoclonal antibody

• 

  WB analysis using 67659-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67659-1-Ig (RAB18 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 67659-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67659-1-Ig (RAB18 antibody) at dilution of 1:350 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 67659-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67659-1-Ig (RAB18 antibody) at dilution of 1:350 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RAB18 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67659-1-Ig

Clone No.2E4B3

Publications(1)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

2E4B3, RAB18LI1, Ras related protein Rab 18, Ras-related protein Rab-18

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, human testis tissue, pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:175-1:700

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67659-1-Ig targets RAB18 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16669

  Product name: Recombinant human RAB18 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-206 aa of BC015014

  Sequence: MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL

• Full Name: RAB18, member RAS oncogene family
• Calculated Molecular Weight: 206 aa, 23 kDa
• GenBank Accession Number: BC015014
• Gene Symbol: RAB18
• Gene ID (NCBI): 22931
• RRID: AB_2882856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NP72
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		J Gastroenterol Hepatol; Effect of Rab18 on liver injury and lipid accumulation by regulating perilipin 2 and peroxisome proliferator-activated receptor gamma in non-alcoholic fatty liver disease; Authors - Lei Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Christine (Verified Customer) (08-05-2025)

Detects endogenous Rab18 in HEK293T total cell lysates. Very good antibody.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2,000
• Cell Tissue Type: HEK293T