RAB1B Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RAB1B Monoclonal antibody (67837-1-Ig)

• Featured Product
• KD/KO Validated

RAB1B Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67837-1-Ig Copied!

Clone No. 3C2G6

Reviews (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

3C2G6, EC:3.6.5.2, Ras related protein Rab 1B, Ras-related protein Rab-1B

• 

  WB analysis using 67837-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67837-1-Ig (RAB1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 67837-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67837-1-Ig (RAB1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67837-1-Ig

  WB result of RAB1B antibody (67837-1-Ig; 1:15000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAB1B transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat heart using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat heart using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 67837-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 67837-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using RAB1B antibody (67837-1-Ig, Clone: 3C2G6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 67837-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using RAB1B antibody (67837-1-Ig, Clone: 3C2G6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB1B in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, NIH/3T3 cells, HeLa cells, U2OS cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells
• Positive IHC detected in: human lung cancer tissue, human liver cancer tissue, human ovary tumor tissue, human pancreas cancer tissue, human stomach cancer tissue, rat brain tissue, rat heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67837-1-Ig targets RAB1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12069

  Product name: Recombinant human RAB1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC071169

  Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

• Full Name: RAB1B, member RAS oncogene family
• Calculated Molecular Weight: 201 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC071169
• Gene Symbol: RAB1B
• Gene ID (NCBI): 81876
• RRID: AB_2918599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H0U4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

This product has received one review with a 5-star rating. The reviewer used it for Western Blot on human samples and reported that it performed well for WB. Overall, the feedback is positive, indicating reliable performance in its tested application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Boyan (Verified Customer) (01-13-2026)

good for WB

• Applications: Western Blot
• Cell Tissue Type: human