RAB1B Monoclonal antibody, PBS Only

• 

  WB analysis using 67837-1-Ig (same clone as 67837-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67837-1-Ig (RAB1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67837-1-Ig (same clone as 67837-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67837-1-Ig (RAB1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67837-1-Ig (same clone as 67837-1-PBS)

  WB result of RAB1B antibody (67837-1-Ig; 1:15000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAB1B transfected HeLa cells. This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 67837-1-Ig (RAB1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using RAB1B antibody (67837-1-Ig, Clone: 3C2G6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 67837-1-Ig (same clone as 67837-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using RAB1B antibody (67837-1-Ig, Clone: 3C2G6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67837-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RAB1B Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67837-1-PBS

Clone No.3C2G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

3C2G6, EC:3.6.5.2, Ras related protein Rab 1B, Ras-related protein Rab-1B

---

Product Information

67837-1-PBS targets RAB1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12069

  Product name: Recombinant human RAB1B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC071169

  Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC

• Full Name: RAB1B, member RAS oncogene family
• Calculated Molecular Weight: 201 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC071169
• Gene Symbol: RAB1B
• Gene ID (NCBI): 81876
• RRID: AB_2918599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9H0U4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.