• Featured Product
  • KD/KO Validated

RAB21 Recombinant monoclonal antibody

RAB21 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 84776-2-RR
Clone No.242117C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

242117C4, KIAA0118, Ras related protein Rab 21

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, HepG2 cells, LNCaP cells, MDA-MB-231 cells
Positive IHC detected inhuman colon tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84776-2-RR targets RAB21 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35291

Product name: Recombinant human RAB21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 115-225 aa of NM_014999

Sequence: KELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG

Predict reactive species
Full Name RAB21, member RAS oncogene family
Calculated Molecular Weight24 kDa
Observed Molecular Weight24 kDa
GenBank Accession NumberNM_014999
Gene Symbol RAB21
Gene ID (NCBI) 23011
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UL25
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Small GTPase Rab21 is a ubiquitously expressed and has recently been shown to associate with the α tails of several integrins via the shared conserved membrane proximal sequence, thus regulating cell adhesion and migration via controlling the endo/exocytic trafficking of most integrin heterodimers (PMID: 18804435). Rab21 is required for the pruning of the immature neurites during the multipolar-to-bipolar transition (PMID: 36683567). Knock down of Rab21 impairs integrin-mediated cell adhesion and motility, whereas its overexpression stimulates cell migration and cancer cell adhesion to collagen and human bone (PMID: 16754960).

Protocols

Product Specific Protocols
IF protocol for RAB21 antibody 84776-2-RRDownload protocol
IHC protocol for RAB21 antibody 84776-2-RRDownload protocol
WB protocol for RAB21 antibody 84776-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...