RAB21 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 84776-2-RR (same clone as 84776-2-PBS)

  WB result of RAB21 antibody (84776-2-RR; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAB21 transfected MCF-7 cells. This data was developed using the same antibody clone with 84776-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 84776-2-RR (same clone as 84776-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84776-2-RR (RAB21 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84776-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 84776-2-RR (same clone as 84776-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84776-2-RR (RAB21 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84776-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 84776-2-RR (same clone as 84776-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 84776-2-RR (RAB21 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84776-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 84776-2-RR (same clone as 84776-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 84776-2-RR (RAB21 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84776-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 84776-2-RR (same clone as 84776-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84776-2-RR (RAB21 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84776-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84776-2-RR (same clone as 84776-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RAB21 antibody (84776-2-RR, Clone: 242117C4 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84776-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84776-2-RR

  Biolayer interferometry (BLl) kinetic assays of 84776-2-RR against Human RAB21 were performed. The affinity constant is 0.388 nM.

• Featured Product
• KD/KO Validated

RAB21 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84776-2-PBS

Clone No.242117C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

242117C4, KIAA0118, Ras related protein Rab 21

---

Product Information

84776-2-PBS targets RAB21 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35291

  Product name: Recombinant human RAB21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 115-225 aa of NM_014999

  Sequence: KELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG

• Full Name: RAB21, member RAS oncogene family
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: NM_014999
• Gene Symbol: RAB21
• Gene ID (NCBI): 23011
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UL25
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Small GTPase Rab21 is a ubiquitously expressed and has recently been shown to associate with the α tails of several integrins via the shared conserved membrane proximal sequence, thus regulating cell adhesion and migration via controlling the endo/exocytic trafficking of most integrin heterodimers (PMID: 18804435). Rab21 is required for the pruning of the immature neurites during the multipolar-to-bipolar transition (PMID: 36683567). Knock down of Rab21 impairs integrin-mediated cell adhesion and motility, whereas its overexpression stimulates cell migration and cancer cell adhesion to collagen and human bone (PMID: 16754960).