RAB22A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAB22A Polyclonal antibody (12125-1-AP)

• Featured Product
• KD/KO Validated

RAB22A Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12125-1-AP Copied!

Publications (28)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Rab 22, RAB22, RAB22A, Ras related protein Rab 22A

• 

  WB analysis of COLO 320 using 12125-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 12125-1-AP (RAB22A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of BxPC-3 using 12125-1-AP

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 12125-1-AP (RAB22A antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 12125-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12125-1-AP (RAB22A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 12125-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 12125-1-AP (RAB22A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of COLO 320 using 12125-1-AP

  IP result of anti-RAB22A (IP:12125-1-AP, 4ug; Detection:12125-1-AP 1:300) with COLO 320 cells lysate 2560 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12125-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 12125-1-AP (RAB22A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB22A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Jurkat cells, BxPC-3 cells, A375 cells
• Positive IP detected in: COLO 320 cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12125-1-AP targets RAB22A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, canine, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2769

  Product name: Recombinant human RAB22A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC015710

  Sequence: MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

• Full Name: RAB22A, member RAS oncogene family
• Calculated Molecular Weight: 194 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC015710
• Gene Symbol: RAB22A
• Gene ID (NCBI): 57403
• RRID: AB_2173765
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL26
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB22A is a small GTPase that is expressed ubiquitously in mammalian tissues. It localizes in the MHCI-containing recycling endosomal tubules and functions in endocytic pathway. RAB22A may regulate the dynamic interactions of endosomal compartments and it may be involved in the communication between the biosynthetic and early endocytic pathways. It shares 81% identity with RAB31.

Publications

What published studies show

The RAB22A Polyclonal antibody (Cat# 12125-1-AP) has 28 citations spanning journals including Nature Cell Biology, Advanced Science, Oncogene, EMBO Reports, Journal of Extracellular Vesicles, Clinical Cancer Research, and Molecular Biology of the Cell. Research fields cover endosomal trafficking and recycling, exosome/microvesicle biology, cancer (colorectal, breast, gastric, hepatocellular, melanoma), chemoresistance, neurobiology, prion disease, and macrophage-mediated invasion. Applications include WB, IF, IHC, and IP across human, mouse, and other species.

Automatically generated from the 28 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Cell Biol; An ARF6-Exportin-5 axis delivers pre-miRNA cargo to tumour microvesicles.; Authors - James W Clancy
human	WB,IF	J Extracell Vesicles; RAB22A sorts epithelial growth factor receptor (EGFR) from early endosomes to recycling endosomes for microvesicles release; Authors - Yujie Lin ; KO Validated
mouse, human	WB	Adv Sci (Weinh); RNA-Binding Protein RBM25 Targets the mRNA Stability of GTPase Rab22a to Restrict Viral Entry and Infection.; Authors - Yingying Ding
human	WB,IP	Adv Sci (Weinh); Genomic Amplification of TBC1D31 Promotes Hepatocellular Carcinoma Through Reducing the Rab22A-Mediated Endolysosomal Trafficking and Degradation of EGFR; Authors - Pengbo Cao ; KD Validated
human	IHC	J Control Release; An off-the-shelf small extracellular vesicle nanomedicine for tumor targeting therapy; Authors - Liang Gong
mouse	IF	Int J Biol Sci; Hypoxia preconditioned renal tubular epithelial cell-derived extracellular vesicles alleviate renal ischaemia-reperfusion injury mediated by the HIF-1α/Rab22 pathway and potentially affected by microRNAs.; Authors - Lei Zhang