RAB22A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85986-2-RR (same clone as 85986-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85986-2-RR (RAB22A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85986-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85986-2-RR

  Biolayer interferometry (BLl) kinetic assays of 85986-2-RR against Human RAB22A were performed. The affinity constant is 1.55 nM.

RAB22A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85986-2-PBS

Clone No.250387G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Rab 22, RAB22, Rab-22, Ras related protein Rab 22A, Ras-related protein Rab-22A

---

Product Information

85986-2-PBS targets RAB22A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2769

  Product name: Recombinant human RAB22A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-194 aa of BC015710

  Sequence: MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

• Full Name: RAB22A, member RAS oncogene family
• Calculated Molecular Weight: 194 aa, 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC015710
• Gene Symbol: RAB22A
• Gene ID (NCBI): 57403
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UL26
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB22A is a small GTPase that is expressed ubiquitously in mammalian tissues. It localizes in the MHCI-containing recycling endosomal tubules and functions in endocytic pathway. RAB22A may regulate the dynamic interactions of endosomal compartments and it may be involved in the communication between the biosynthetic and early endocytic pathways. It shares 81% identity with RAB31.