CoraLite® Plus 488-conjugated RAB33A Monoclonal antibody

RAB33A Monoclonal Antibody for IF/ICC
Cat No. CL488-68389
Clone No.1C7F11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

IF/ICC

1C7F11, RABS10, Ras related protein Rab 33A, Ras-related protein Rab-33A, Small GTP binding protein S10

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68389 targets RAB33A in IF/ICC applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33188

Product name: Recombinant human RAB33A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-237 aa of BC009996

Sequence: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC

Predict reactive species
Full Name RAB33A, member RAS oncogene family
Calculated Molecular Weight 27 kDa
GenBank Accession NumberBC009996
Gene Symbol RAB33A
Gene ID (NCBI) 9363
RRIDAB_3673001
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ14088
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ras-related protein Rab-33A (RAB33A) is also named as RABS10, and belongs to the small GTPase superfamily and the Rab family. RAB33A is an X-linked gene that is expressed in brain, lymphocytes, and normal melanocytes, but is downregulated in melanoma cells. In the brain, RAB33A is present throughout the cortex, as well as in the hippocampal CA fields (PMID:16810302). RAB33A is expressed in cells, including neurons, lymphocytes, melanocytes and parotid acinar cells (PMID:16810302, PMID:25871792). In cultured rat hippocampal neurons, RAB33A is localized to the Golgi apparatus and post-Golgi vesicles transported along axons (PMID:22972995).In addition, RAB33A interacts with singar1/RUFY3, which suppresses the formation of surplus axons in cultured hippocampal neurons (PMID:21737958, PMID:17439943).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RAB33A antibody CL488-68389Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...