RAB33B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAB33B Polyclonal antibody, PBS Only (27349-1-PBS)

• 

  WB analysis of HeLa using 27349-1-AP (same clone as 27349-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27349-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27349-1-AP (same clone as 27349-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27349-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 27349-1-AP (same clone as 27349-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27349-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 27349-1-AP (same clone as 27349-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 27349-1-AP (RAB33B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27349-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 27349-1-AP (same clone as 27349-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 27349-1-AP (RAB33B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27349-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 27349-1-AP (same clone as 27349-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 27349-1-AP (RAB33B antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27349-1-PBS in a different storage buffer formulation.

RAB33B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27349-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Ras-related protein Rab-33B, Ras related protein Rab 33B

---

Product Information

27349-1-PBS targets RAB33B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24181

  Product name: Recombinant human RAB33B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-229 aa of BC036064

  Sequence: IGDSNVGKTCLTYRFCAGRFPDHTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQPPDNGIILKPEPKPAMTCWC

• Full Name: RAB33B, member RAS oncogene family
• Calculated Molecular Weight: 229 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC036064
• Gene Symbol: RAB33B
• Gene ID (NCBI): 83452
• RRID: AB_2880851
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H082
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB33B is a small GTP-binding protein of the Rab GTPase family, whose members function in vesicle transport during protein secretion and endocytosis. Rab GTPases are active, membrane-associated proteins that recruit effector proteins in the GTP-bound state and inactive cytosolic proteins when in a GDP-bound state. RAB33B is ubiquitously expressed and has been implicated in Golgi to endoplasmic reticulum cycling of Golgi enzymes. In addition, RAB33B regulates Golgi homeostasis and coordinates intra-Golgi retrograde trafficking.