RAB34 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAB34 Polyclonal antibody (27435-1-AP)

• Featured Product
• KD/KO Validated

RAB34 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27435-1-AP Copied!

Publications (9)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Ras-related protein Rab-34, Ras related protein Rah, Ras related protein Rab 39, Ras related protein Rab 34, RAH

• 

  WB analysis using 27435-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27435-1-AP (RAB34 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 27435-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27435-1-AP (RAB34 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary cancer using 27435-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27435-1-AP (RAB34 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RAB34 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HeLa cells, U2OS cells, A549 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27435-1-AP targets RAB34 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26696

  Product name: Recombinant human RAB34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 126-251 aa of BC016841

  Sequence: QAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP

• Full Name: RAB34, member RAS oncogene family
• Calculated Molecular Weight: 251 aa, 28 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC016841
• Gene Symbol: RAB34
• Gene ID (NCBI): 83871
• RRID: AB_2880870
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZG1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB34, a Rab protein family member, is involved in repositioning of lysosomes, activation of micropinocytosis, and protein transport. RAB34 is aberrantly expressed in various cancers and exhibits oncogenic properties. Recently, Rab34 is identified as a ciliary protein. Rab34 is required for internal assembly of cilia but not for cilia built on the cell surface.

Publications

What published studies show

The RAB34 Polyclonal antibody (Cat# 27435-1-AP) has 9 citations published in Current Biology, Biomedicines, Kaohsiung Journal of Medical Sciences, Human Molecular Genetics, bioRxiv, and eLife. Research fields span ciliogenesis and primary cilium assembly, Hedgehog-MAPK signaling in melanoma, insulin secretion via lysosomal proinsulin degradation, pathogenic RAB34 variants in oral-facial-digital syndrome, neuronal calcium sensing, and centriolar satellite-mediated centriole remodeling.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF, WB	Curr Biol; Rab34 GTPase mediates ciliary membrane formation in the intracellular ciliogenesis pathway.; Authors - Anil Kumar Ganga ; KD Validated
human	WB,IF	Biomedicines; Signaling Switching from Hedgehog-GLI to MAPK Signaling Potentially Serves as a Compensatory Mechanism in Melanoma Cell Lines Resistant to GANT-61; Authors - Nikolina Piteša
mouse	WB	Kaohsiung J Med Sci; miR-9 Restricts Insulin Secretion by Targeting Rab34, Which Mediates Lysosomal Degradation of Proinsulin.; Authors - Zhen-Zhen Guo ; KD Validated
human	WB	Hum Mol Genet; Pathogenic RAB34 variants impair primary cilium assembly and cause a novel oral-facial-digital syndrome; Authors - Ange-Line Bruel
human	IF	Elife; Centriolar satellites expedite mother centriole remodeling to promote ciliogenesis; Authors - Emma A Hall
human	WB,IF	Elife; Myristoylated Neuronal Calcium Sensor-1 captures the preciliary vesicle at distal appendages; Authors - Tomoharu Kanie