RAB35 Monoclonal antibody, PBS Only

• 

  WB analysis using 68552-1-Ig (same clone as 68552-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68552-1-Ig (RAB35 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68552-1-PBS in a different storage buffer formulation.

RAB35 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68552-1-PBS

Clone No.3H3E1

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat, rabbit

Applications

WB, Indirect ELISA

Synonyms

GTP binding protein RAY, H ray, RAB1C, RAB35, Ras related protein Rab 1C, Ras related protein Rab 35, RAY

---

Product Information

68552-1-PBS targets RAB35 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples.

• Tested Reactivity: Human, mouse, rat, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21424

  Product name: Recombinant human RAB35 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC015931

  Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

• Full Name: RAB35, member RAS oncogene family
• Calculated Molecular Weight: 201 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC015931
• Gene Symbol: RAB35
• Gene ID (NCBI): 11021
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15286
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB35 is a member of the small GTPase superfamily. Like the other Rab proteins, RAB35 has 2 consecutive cysteine residues at its C terminus, and this region is thought to be involved in membrane association. Rab35 is found on the cell surface and endosomes, where it has been proposed to play a role in recycling of the transferrin and other receptors.