RAB35 Monoclonal antibody

RAB35 Monoclonal Antibody for WB, ELISA
Cat No. 68552-1-Ig
Clone No.3H3E1

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat, rabbit

Applications

WB, ELISA

GTP binding protein RAY, H ray, RAB1C, RAB35, Ras related protein Rab 1C, Ras related protein Rab 35, RAY

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68552-1-Ig targets RAB35 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples.

Tested Reactivity Human, mouse, rat, rabbit
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21424

Product name: Recombinant human RAB35 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-201 aa of BC015931

Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

Predict reactive species
Full Name RAB35, member RAS oncogene family
Calculated Molecular Weight 201 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC015931
Gene Symbol RAB35
Gene ID (NCBI) 11021
RRIDAB_3085256
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15286
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB35 is a member of the small GTPase superfamily. Like the other Rab proteins, RAB35 has 2 consecutive cysteine residues at its C terminus, and this region is thought to be involved in membrane association. Rab35 is found on the cell surface and endosomes, where it has been proposed to play a role in recycling of the transferrin and other receptors.

Protocols

Product Specific Protocols
WB protocol for RAB35 antibody 68552-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...