RAB39B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAB39B Polyclonal antibody, PBS Only (12162-1-PBS)

• 

  WB analysis of fetal human brain using 12162-1-AP (same clone as 12162-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 12162-1-AP (RAB39B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12162-1-AP (same clone as 12162-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12162-1-AP (RAB39B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12162-1-AP (same clone as 12162-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12162-1-AP (RAB39B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 12162-1-AP (same clone as 12162-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12162-1-AP (RAB39B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 12162-1-AP (same clone as 12162-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12162-1-AP (RAB39B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SH-SY5Y using 12162-1-AP (same clone as 12162-1-PBS)

  IP result of anti-RAB39B (IP:12162-1-AP, 4ug; Detection:12162-1-AP 1:1000) with SH-SY5Y cells lysate 2200 ug. This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 12162-1-AP (same clone as 12162-1-PBS)

  IP result of anti-RAB39B (IP:12162-1-AP, 4ug; Detection:12162-1-AP 1:300) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 12162-1-AP (same clone as 12162-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 12162-1-AP (RAB39B antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12162-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RAB39B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12162-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12162-1-PBS targets RAB39B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2803

  Product name: Recombinant human RAB39B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC009714

  Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC

• Full Name: RAB39B, member RAS oncogene family
• Calculated Molecular Weight: 213 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC009714
• Gene Symbol: RAB39B
• Gene ID (NCBI): 116442
• RRID: AB_2177360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96DA2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.