CoraLite® Plus 488-conjugated RAB3A Monoclonal antibody

RAB3A Monoclonal Antibody for WB
Cat No. CL488-68052
Clone No.1B12E9

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB

1B12E9, Ras related protein Rab 3A, Ras-related protein Rab-3A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68052 targets RAB3A in WB applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8148

Product name: Recombinant human RAB3A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-220 aa of BC011782

Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Predict reactive species
Full Name RAB3A, member RAS oncogene family
Calculated Molecular Weight 25 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberBC011782
Gene Symbol RAB3A
Gene ID (NCBI) 5864
RRIDAB_2923871
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20336
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Rab3A is a small G-protein of the Rab family, that is implicated in vesicle fusion and regulated secretion, particularly in neurotransmitter release. Rab3 subfamily small G proteins (Rab3A, Rab3B, Rab3C, and Rab3D) control the regulated exocytosis in neuronal/secretory cells. Rab3A is the most abundant Rab GTPase in brain, where it is associated with synaptic vesicles. Rab3a is believed to modulate secretion efficiency by stimulating vesicle recruitment to sites of exocytosis and/ or by recruiting regulatory molecules to the docking/ fusion machinery.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 RAB3A antibody CL488-68052Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...