RAB3B/C Polyclonal antibody

• 

  WB analysis using 15774-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15774-1-AP (RAB3B/C antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15774-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15774-1-AP (RAB3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15774-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15774-1-AP (RAB3B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-251 using 15774-1-AP

  U-251 cells were subjected to SDS PAGE followed by western blot with 15774-1-AP (RAB3B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 15774-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15774-1-AP (RAB3B antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 15774-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15774-1-AP (RAB3B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas using 15774-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 15774-1-AP (RAB3B Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 15774-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 15774-1-AP (RAB3B Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of rat brain using 15774-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15774-1-AP (RAB3B/C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 15774-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 15774-1-AP (RAB3B/C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 15774-1-AP

  Immunofluorescent analysis of HeLa cells using 15774-1-AP (RAB3B antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 15774-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug RAB3B/C Polyclonal antibody (15774-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

RAB3B/C Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 15774-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

RAB3B, Ras related protein Rab 3B, Ras-related protein Rab-3B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, U-251 cells, rat brain tissue
• Positive IHC detected in: rat brain tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

15774-1-AP targets RAB3B/C in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8441

  Product name: Recombinant human RAB3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-219 aa of BC005035

  Sequence: MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC

• Full Name: RAB3B, member RAS oncogene family
• Calculated Molecular Weight: 219 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC005035
• Gene Symbol: RAB3B
• Gene ID (NCBI): 5865
• RRID: AB_2177414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20337
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Ann Neurol; PMID: 32167609; Authors - Jimena Monzón-Sandoval
mouse	WB	Hum Mol Genet; Progressive axonal transport and synaptic protein changes correlate with behavioral and neuropathological abnormalities in the heterozygous Q175 KI mouse model of Huntington's disease.; Authors - Gaynor A Smith
human	WB,IF	Cell Death Dis; Long noncoding RNA ENST00000436340 promotes podocyte injury in diabetic kidney disease by facilitating the association of PTBP1 with RAB3B; Authors - Jinxiu Hu
human	WB	Adv Sci (Weinh); Evoked Weibel-Palade Body Exocytosis Modifies the Endothelial Cell Surface by Releasing a Substrate-Selective Phosphodiesterase; Authors - Johannes Naß
human	IHC	Sci Rep; Pan-cancer analysis reveals correlation between RAB3B expression and tumor heterogeneity, immune microenvironment, and prognosis in multiple cancers; Authors - Xu-Sheng Liu
		Nat Commun; Rab27a regulates the transport of influenza virus membrane proteins to the plasma membrane; Authors - Tong Chen