RAB3C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RAB3C Polyclonal antibody, PBS Only (10788-1-PBS)

• 

  WB analysis using 10788-1-AP (same clone as 10788-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10788-1-AP (RAB3C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10788-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 10788-1-AP (same clone as 10788-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10788-1-AP (RAB3C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10788-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10788-1-AP (same clone as 10788-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10788-1-AP (RAB3C antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10788-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 10788-1-AP (same clone as 10788-1-PBS)

  IP result of anti-RAB3C (IP:10788-1-AP, 4ug; Detection:10788-1-AP 1:300) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 10788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10788-1-AP (same clone as 10788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10788-1-AP (RAB3C antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10788-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 10788-1-AP (same clone as 10788-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10788-1-AP (RAB3C antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10788-1-PBS in a different storage buffer formulation.

RAB3C Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10788-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

10788-1-PBS targets RAB3C in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1241

  Product name: Recombinant human RAB3C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-227 aa of BC013033

  Sequence: MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC

• Full Name: RAB3C, member RAS oncogene family
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC013033
• Gene Symbol: RAB3C
• Gene ID (NCBI): 115827
• RRID: AB_2177217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96E17
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rab proteins are small molecular weight GTPases that control vesicular traffic in eukaryotic cells. A subset of Rab proteins, the Rab3 proteins (Rab3A, Rab3B, Rab3C, and Rab3D) are thought to play an important role in regulated exocytosis of vesicles. Although Rab3 proteins are highly homologous, displaying 77-85% amino acid identity with greatest variance evident within the N- and C-terminal regions, their subcellular targets and functional roles remain somewhat distinct between them. RT-PCR analysis indicated that human Rab3C was expressed in the human brain, placenta, and lung.