RAB3D Monoclonal antibody

• 

  WB analysis of NCI-H1299 using 67118-1-Ig

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 67118-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HT-29 using 67118-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of THP-1 using 67118-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 67118-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67118-1-Ig (RAB3D antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67118-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67118-1-Ig (RAB3D antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 67118-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using RAB3D antibody (67118-1-Ig, Clone: 3C2F10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

RAB3D Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67118-1-Ig

Clone No.3C2F10

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

D2 2, GOV, RAB16, RAB3D, RAD3D, Ras related protein Rab 3D

---

Tested Applications

• Positive WB detected in: NCI-H1299 cells, A549 cells, HT-29 cells, THP-1 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67118-1-Ig targets RAB3D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16784

  Product name: Recombinant human RAB3D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-219 aa of BC016471

  Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC

• Full Name: RAB3D, member RAS oncogene family
• Calculated Molecular Weight: 219 aa, 24 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC016471
• Gene Symbol: RAB3D
• Gene ID (NCBI): 9545
• RRID: AB_2882421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95716
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tom (Verified Customer) (11-13-2020)

HEK293T cell extracts (10ug/lane). Primary antibody (1:2500) in block (5% BSA) incubated at 4 degrees overnight. Goat anti-mouse HRP secondary antibody (1:10,000) incubated for 1 hour at RT.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2500
• Cell Tissue Type: HEK293T

RAB3D Antibody Western Blot validation (1:2500 dilution) in HEK293T (Cat no:67118-1-Ig)