RAB3D Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RAB3D Monoclonal antibody (67118-1-Ig)

RAB3D Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67118-1-Ig

Clone No.3C2F10

Reviews (1)

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

3C2F10, GOV, RAB16, RAD3D, Ras related protein Rab 3D

• 

  WB analysis of NCI-H1299 using 67118-1-Ig

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 67118-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HT-29 using 67118-1-Ig

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of THP-1 using 67118-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67118-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67118-1-Ig (RAB3D antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67118-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67118-1-Ig (RAB3D antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 67118-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using RAB3D antibody (67118-1-Ig, Clone: 3C2F10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: NCI-H1299 cells, A549 cells, HT-29 cells, THP-1 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67118-1-Ig targets RAB3D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16784

  Product name: Recombinant human RAB3D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-219 aa of BC016471

  Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC

• Full Name: RAB3D, member RAS oncogene family
• Calculated Molecular Weight: 219 aa, 24 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: BC016471
• Gene Symbol: RAB3D
• Gene ID (NCBI): 9545
• RRID: AB_2882421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95716
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Tom (Verified Customer) (11-13-2020)

HEK293T cell extracts (10ug/lane). Primary antibody (1:2500) in block (5% BSA) incubated at 4 degrees overnight. Goat anti-mouse HRP secondary antibody (1:10,000) incubated for 1 hour at RT.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2500
• Cell Tissue Type: HEK293T

RAB3D Antibody Western Blot validation (1:2500 dilution) in HEK293T (Cat no:67118-1-Ig)