RAB3D Monoclonal antibody, PBS Only

• 

  WB analysis of NCI-H1299 using 67118-1-Ig (same clone as 67118-1-PBS)

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 67118-1-Ig (same clone as 67118-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-29 using 67118-1-Ig (same clone as 67118-1-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 67118-1-Ig (same clone as 67118-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 67118-1-Ig (RAB3D antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67118-1-Ig (same clone as 67118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67118-1-Ig (RAB3D antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67118-1-Ig (same clone as 67118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67118-1-Ig (RAB3D antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67118-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 67118-1-Ig (same clone as 67118-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A549 cells using RAB3D antibody (67118-1-Ig, Clone: 3C2F10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67118-1-PBS in a different storage buffer formulation.

RAB3D Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67118-1-PBS

Clone No.3C2F10

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

D2 2, GOV, RAB16, RAB3D, RAD3D, Ras related protein Rab 3D

---

Product Information

67118-1-PBS targets RAB3D in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16784

  Product name: Recombinant human RAB3D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-219 aa of BC016471

  Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC

• Full Name: RAB3D, member RAS oncogene family
• Calculated Molecular Weight: 219 aa, 24 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC016471
• Gene Symbol: RAB3D
• Gene ID (NCBI): 9545
• RRID: AB_2882421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95716
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.