RAB3D Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAB3D Recombinant monoclonal antibody, PBS Only (Capture) (87655-2-PBS)

• 

  WB analysis using 87655-2-RR (same clone as 87655-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87655-2-RR (RAB3D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87655-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP03138-1

  The mean RAB3D concentration was determined to be 15.4 ng/mL in SK-BR-3 cell extract based on a 1.5 mg/mL extract load, HT-1080 cell extract were served as a negative control.

• 

  Cytometric bead array standard curve of MP03138-1

  Cytometric bead array standard curve of MP03138-1, RAB3D Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87655-2-PBS. Detection antibody: 87655-3-PBS. Standard: Eg5570. Range: 0.156-20 ng/mL.

• 

  Affinity of 87655-2-RR

  Biolayer interferometry (BLl) kinetic assays of 87655-2-RR against Human RAB3D were performed. The affinity constant is 2.66 nM.

RAB3D Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 87655-2-PBS

Clone No.253078A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

GOV, RAB16, RAD3D, Ras related protein Rab 3D, Ras-related protein Rab-3D

---

Product Information

87655-2-PBS targets RAB3D as part of a matched antibody pair:

MP03138-1: 87655-2-PBS capture and 87655-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5570

  Product name: Recombinant human RAB3D protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-219 aa of NM_004283.3

  Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC

• Full Name: RAB3D, member RAS oncogene family
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: NM_004283.3
• Gene Symbol: RAB3D
• Gene ID (NCBI): 9545
• RRID: AB_3745677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95716
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rab3D is a member of the Rab3 subfamily, which comprises four isoforms (Rab3A, Rab3B, Rab3C, and Rab3D). Rab3 proteins typically associate with secretory vesicles, including synaptic vesicles, and have been implicated in the control of regulated exocytosis. Rab3D is widely expressed in adipocytes, exocrine glands and several haematopoietic cells, where it localizes to secretory granules and vesicles.