RAB3D Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAB3D Recombinant monoclonal antibody (87655-2-RR)

• 

  WB analysis using 87655-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87655-2-RR (RAB3D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

RAB3D Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87655-2-RR

Clone No.253078A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GOV, RAB16, RAD3D, Ras related protein Rab 3D, Ras-related protein Rab-3D

---

Tested Applications

• Positive WB detected in: BxPC-3 cells, TT cells, A549 cells, SW 1990 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87655-2-RR targets RAB3D in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5570

  Product name: Recombinant human RAB3D protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1-219 aa of NM_004283.3

  Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC

• Full Name: RAB3D, member RAS oncogene family
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: NM_004283.3
• Gene Symbol: RAB3D
• Gene ID (NCBI): 9545
• RRID: AB_3745677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95716
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab3D is a member of the Rab3 subfamily, which comprises four isoforms (Rab3A, Rab3B, Rab3C, and Rab3D). Rab3 proteins typically associate with secretory vesicles, including synaptic vesicles, and have been implicated in the control of regulated exocytosis. Rab3D is widely expressed in adipocytes, exocrine glands and several haematopoietic cells, where it localizes to secretory granules and vesicles.