RAB5B Polyclonal antibody

• 

• Featured Product
• KD/KO Validated

RAB5B Polyclonal Antibody for ELISA

Cat No. 17605-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

RAB5B, Ras related protein Rab 5B

---

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

17605-1-AP targets RAB5B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11722

  Product name: Recombinant human RAB5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-215 aa of BC032740

  Sequence: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

• Full Name: RAB5B, member RAS oncogene family
• Calculated Molecular Weight: 215 aa, 24 kDa
• GenBank Accession Number: BC032740
• Gene Symbol: RAB5B
• Gene ID (NCBI): 5869
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61020
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Sci Signal; Semaphorin 3A activates the guanosine triphosphatase Rab5 to promote growth cone collapse and organize callosal axon projections.; Authors - Kong-Yan Wu ; KD Validated