Tested Applications
| Positive WB detected in | HEK-293T cells, HeLa cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, mouse lung tissue, rat lung tissue |
| Positive IHC detected in | human stomach tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27403-1-AP targets RAB5B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26584 Product name: Recombinant human RAB5B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-215 aa of BC032740 Sequence: GNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN Predict reactive species |
| Full Name | RAB5B, member RAS oncogene family |
| Calculated Molecular Weight | 215 aa, 24 kDa |
| Observed Molecular Weight | 25-27 kDa |
| GenBank Accession Number | BC032740 |
| Gene Symbol | RAB5B |
| Gene ID (NCBI) | 5869 |
| RRID | AB_2880862 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61020 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RAB5B (Ras-related protein Rab-5B) belongs to the Rab family. Rab5 is specifically localized to the early compartment and regulates endocytosis (PMID:1516130, PMID:9087439). There are three isoforms of Rab5 namely, Rab5a, Rab5b, and Rab5c present in EE of mammalian cells (PMID:7789520). Recently, we have shown that Rab5a regulates fluid-phase endocytosis whereas receptor-mediated endocytosis is regulated by Rab5b in Leishmania (PMID:27226564). Rab5B is a small monomeric G protein that regulates early endocytosis and controls signaling pathways related to cell growth, survival, and apoptosis. Dysregulation of Rab5B protein expression has been linked to the development of several cancers such as leukemia, lymphoma, kidney, prostate, ovarian, breast cancer, etc. (PMID: 37505376)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAB5B antibody 27403-1-AP | Download protocol |
| IHC protocol for RAB5B antibody 27403-1-AP | Download protocol |
| WB protocol for RAB5B antibody 27403-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
bioRxiv The Sde Phosphoribosyl-Linked Ubiquitin Transferases protect the Legionella pneumophila vacuole from degradation by the host
| ||
Cell Rep Nutrient stress activates RAB5B-mediated autophagy to remodel the synaptic proteome. | ||
Nat Commun Lipid turnover and GEF recruitment collectively determine Rab5 recruitment and activation during the first step of early endosome formation. | ||
Mol Hum Reprod Hsa_circRNA_BECN1 acts as a ceRNA to promote polycystic ovary syndrome progression by sponging the miR-619-5p/Rab5b axis |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xin (Verified Customer) (04-15-2022) | It is ok to detect endogenous Rab5B, although the signal is a little weak.
![]() |
















