Product Information
86540-5-PBS targets RAB8A in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30567 Product name: Recombinant human RAB8A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 150-204 aa of NM_005370 Sequence: TSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRC Predict reactive species |
| Full Name | RAB8A, member RAS oncogene family |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | NM_005370 |
| Gene Symbol | RAB8A |
| Gene ID (NCBI) | 4218 |
| RRID | AB_3744953 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P61006 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The Rab8 GTPase is a member of the Ras superfamily that functions in protein transport and membrane restructuring. RAB8 has two isoforms, RAB8A and RAB8B, that share 40% amino acid identity in the C-terminal variable region. RAB8 activity is regulated by specific guanine nucleotide exchange factors (GEFs), that mediate GTP loading, and GTPase activating proteins (GAPs) that convert them into the inactive GDP-bound form. RAB8 participates in recycling of the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors to the dendritic spine surface as well as in the intracellular transport of the metabotropic glutamate receptor type 1 in neuronal cells. Rab8 is activated at the base of the cilium by its guanine nucleotide exchanger Rabin8. The antibody 11792-1-AP can detect both RAB8A and RAB8B.



