RAB8A Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RAB8A Recombinant monoclonal antibody (86540-5-RR)

RAB8A Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86540-5-RR

Clone No.251429D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

EC:3.6.5.2, MEL, Oncogene c mel, Oncogene c-mel, RAB8

• 

  WB analysis using 86540-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86540-5-RR (RAB8A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86540-5-RR

  Biolayer interferometry (BLl) kinetic assays of 86540-5-RR against Human RAB8A were performed. The affinity constant is 4.84 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, HepG2 cells, fetal human brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86540-5-RR targets RAB8A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30567

  Product name: Recombinant human RAB8A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 150-204 aa of NM_005370

  Sequence: TSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRC

• Full Name: RAB8A, member RAS oncogene family
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: NM_005370
• Gene Symbol: RAB8A
• Gene ID (NCBI): 4218
• RRID: AB_3744953
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P61006
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Rab8 GTPase is a member of the Ras superfamily that functions in protein transport and membrane restructuring. RAB8 has two isoforms, RAB8A and RAB8B, that share 40% amino acid identity in the C-terminal variable region. RAB8 activity is regulated by specific guanine nucleotide exchange factors (GEFs), that mediate GTP loading, and GTPase activating proteins (GAPs) that convert them into the inactive GDP-bound form. RAB8 participates in recycling of the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors to the dendritic spine surface as well as in the intracellular transport of the metabotropic glutamate receptor type 1 in neuronal cells. Rab8 is activated at the base of the cilium by its guanine nucleotide exchanger Rabin8. The antibody 11792-1-AP can detect both RAB8A and RAB8B.