RAB9B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85394-1-RR (same clone as 85394-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85394-1-RR (RAB9B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85394-1-PBS in a different storage buffer formulation.

• 

  Affinity of 85394-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85394-1-RR against Human RAB9B were performed. The affinity constant is 12.6 nM.

RAB9B Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85394-1-PBS

Clone No.242790A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Rab 9 like protein, Rab 9L, RAB9L, Rab-9L, Rab-9-like protein

---

Product Information

85394-1-PBS targets RAB9B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12862

  Product name: Recombinant human RAB9B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC093756

  Sequence: MSGKSLLLKVILLGDGGVGKSSLMNRYVTNKFDSQAFHTIGVEFLNRDLEVDGRFVTLQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC

• Full Name: RAB9B, member RAS oncogene family
• Calculated Molecular Weight: 201 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC093756
• Gene Symbol: RAB9B
• Gene ID (NCBI): 51209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NP90
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB9B, also named as RAB9L, is involved in the transport of proteins between the endosomes and the trans Golgi network. RAB9B belongs to the Ras-related superfamily of guanine nucleotide binding proteins, which includes the Ral/Rec, Rap, R-Ras, and Rho/Rab subfamilies